DPCfam | MC270101
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 139 ± 9 aa |
| Residues in low-complexity regions (%) | 1.66 |
| Residues in coiled-coil regions (%) | 1.38 |
| Predicted disordered residues (%) | 7.27 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF03177 |
| Sequences matching dominant architecture (%) | 1.82 |
| Average overlap percent | 13.61 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R7UIK9 | 1194-1338 | 145 | LGRTYGGNDKYFPLAFLVKLLEIQSCKLGLHEADQRFVFSTMQQIGVTIPRLHEIYDRLYKSKDPCWRTAHRPHHLLFIIHQLLV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P37199-F1 | 1250-1389 | 100.00 | 88.31 | View in AlphaFoldDB ↗ |