DPCfam | MC269982
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 681 |
|---|---|
| Mean domain length (aa) | 150 ± 27 aa |
| Residues in low-complexity regions (%) | 2.43 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.48 |
| Average transmembrane regions | 0.29 |
| Dominant Pfam architecture(s) | PF04727 |
| Sequences matching dominant architecture (%) | 97.87 |
| Average overlap percent | 85.44 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0A9WC65 | 301-486 | 186 | RMNTKMDSQDQDAHEKIKELRKIAFDTEGSFGNDSIARRQLGVFAKDYKKLGFKSDINPALDFTETPPGMLALDCMVYFARNQTE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0P9E5-F1 | 117-281 | 98.70 | 95.18 | View in AlphaFoldDB ↗ |