DPCfam | MC269780
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 421 |
|---|---|
| Mean domain length (aa) | 245 ± 46 aa |
| Residues in low-complexity regions (%) | 11.23 |
| Residues in coiled-coil regions (%) | 0.27 |
| Predicted disordered residues (%) | 49.36 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF05236 |
| Sequences matching dominant architecture (%) | 93.54 |
| Average overlap percent | 87.55 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00064478FB | 367-643 | 277 | RFKESTGTFRDEDDLNDVASMAGVSVSEERARILATGAESVGLVIRSCRDEPFLCPSALRTRITNTALAGGVSGLEGDIVGLVSH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-E7FFQ2-F1 | 716-973 | 99.21 | 77.30 | View in AlphaFoldDB ↗ |