DPCfam | MC26974
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 135 ± 19 aa |
| Residues in low-complexity regions (%) | 1.6 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.41 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A179F804 | 39-142 | 104 | PSWRTKYRLVYTHPHGISVSGVGLNEDDYPSYWSAPRNFNGRWDDGGYMGLRRDRIGVLQQRPLNGSYGFPIHEACWSLLEVAYA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1GST4-F1 | 5-146 | 99.28 | 86.03 | View in AlphaFoldDB ↗ |