DPCfam | MC269729
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 67 ± 5 aa |
| Residues in low-complexity regions (%) | 7.94 |
| Residues in coiled-coil regions (%) | 23.28 |
| Predicted disordered residues (%) | 20.79 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01813 |
| Sequences matching dominant architecture (%) | 0.68 |
| Average overlap percent | 37.87 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K1XXT9 | 5-69 | 65 | SQALSDEIESLLAEYLSLLNTYTTLRAELTTAQSSIYQNLARANFHAERGVRYGQDCYDERAMQP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0NYJ5-F1 | 38-100 | 95.45 | 92.54 | View in AlphaFoldDB ↗ |