DPCfam | MC269598
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 77 ± 8 aa |
| Residues in low-complexity regions (%) | 0.23 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 9.7 |
| Average transmembrane regions | 0.11 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G0P1M5 | 370-442 | 73 | LEFKLETLLRQWTNSKDVLFSIHPVDGSLLTWTVEWLDDHFRQPVISYSSRLPGAFPTSDSMSLNLKLNTFNP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A158Q410-F1 | 490-615 | 100.00 | 63.93 | View in AlphaFoldDB ↗ |