DPCfam | MC269323
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 460 ± 50 aa |
| Residues in low-complexity regions (%) | 10.98 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 75.88 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H3A2H5 | 1952-2480 | 529 | EEELRTRGKTTMTTANLIDAIITREITSTKDSRERSSQNSDSSSSLSSHRYETMAGDAIEVISPATSPVQTQERAETCQQEVPKP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9WU42-F1 | 2005-2472 | 98.68 | 34.43 | View in AlphaFoldDB ↗ |