DPCfam | MC268731
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 117 ± 19 aa |
| Residues in low-complexity regions (%) | 4.42 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 2.99 |
| Average transmembrane regions | 2.09 |
| Dominant Pfam architecture(s) | PF11145 |
| Sequences matching dominant architecture (%) | 98.33 |
| Average overlap percent | 23.58 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A022RY80 | 754-853 | 100 | SYAGLILGGFLVPQVLFNIFTGSTEKALAECFYVGMSAIRLAPHAYVSGTGYYYAKIRTGEFYSITWGVAIRCGIVVLAVIVYLQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7M2C5-F1 | 789-910 | 100.00 | 74.38 | View in AlphaFoldDB ↗ |