DPCfam | MC268486
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 65 ± 6 aa |
| Residues in low-complexity regions (%) | 1.24 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.68 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13516 |
| Sequences matching dominant architecture (%) | 35.0 |
| Average overlap percent | 16.44 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A7SXT1 | 268-335 | 68 | IGKNPMQSAGAYAILNAMKNNPESALVEVELSDITVNNDFLQLCGEVIAARPNVKITHGGSGGALHKP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A3Q0KKJ9-F1 | 332-395 | 94.12 | 89.73 | View in AlphaFoldDB ↗ |