DPCfam | MC268201
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 295 ± 20 aa |
| Residues in low-complexity regions (%) | 6.33 |
| Residues in coiled-coil regions (%) | 15.32 |
| Predicted disordered residues (%) | 19.09 |
| Average transmembrane regions | 0.28 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0C1U0V7 | 15-320 | 306 | YLVIVVAAISLFCFSYNFFKERTIDSQVNYIDNALKEINTINDRCNDFIVKDSINVNKSLKIIPEMVNELNKIKDDINIQEYDPE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A132Z9T6-F1 | 46-128 | 30.29 | 97.78 | View in AlphaFoldDB ↗ |