DPCfam | MC26797
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 150 ± 16 aa |
| Residues in low-complexity regions (%) | 2.59 |
| Residues in coiled-coil regions (%) | 0.55 |
| Predicted disordered residues (%) | 31.33 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10926 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 42.9 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00085BD8BA | 120-261 | 141 | ELLEWAENELSPKAELAFKGEGEMTSGKHCQFCKLKNVCRKRAEDNLALAKMEFVDPATLDYEDIAEILPKLDLLVSWANDVKAY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q2FY99-F1 | 232-381 | 98.69 | 88.43 | View in AlphaFoldDB ↗ |