DPCfam | MC267875
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 112 ± 9 aa |
| Residues in low-complexity regions (%) | 2.69 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 43.25 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07995 |
| Sequences matching dominant architecture (%) | 97.85 |
| Average overlap percent | 13.92 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A4CMA3 | 516-631 | 116 | LYWGDIGPDAGEDGPQGPKGYDEFNQAKSAGNYGWPYFIGNNRAYTDWDFQQQAGNSTFDPDAPYNDSPNNTGLNQLPPARGAMI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P13650-F1 | 260-346 | 64.41 | 98.53 | View in AlphaFoldDB ↗ |