DPCfam | MC267853
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 318 ± 47 aa |
| Residues in low-complexity regions (%) | 2.2 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.21 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF12260 |
| Sequences matching dominant architecture (%) | 89.41 |
| Average overlap percent | 45.79 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00076FA337 | 45-375 | 331 | LRKCPACYGLSICGAILNNEIVIRHRGVYATFANLFNAKNVFFGNYAGEKVVLKKLAHTSELYAFDKMLCTDSKLFELCPNNSNK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A2CEC6-F1 | 45-387 | 98.78 | 90.83 | View in AlphaFoldDB ↗ |