DPCfam | MC267370
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 261 |
|---|---|
| Mean domain length (aa) | 83 ± 8 aa |
| Residues in low-complexity regions (%) | 10.07 |
| Residues in coiled-coil regions (%) | 0.1 |
| Predicted disordered residues (%) | 51.71 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00520 |
| Sequences matching dominant architecture (%) | 2.33 |
| Average overlap percent | 7.96 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G3HQV9 | 48-130 | 83 | GTTNFRRFTPESLAEIEKQIAAHRAAKKARAKHGERKGQEEKPRPQLDLKACNQLPRFYGELPAELVGEPLEDLDPFYSTHRT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P04775-F1 | 10-92 | 98.85 | 70.87 | View in AlphaFoldDB ↗ |