DPCfam | MC267343
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 321 |
|---|---|
| Mean domain length (aa) | 102 ± 9 aa |
| Residues in low-complexity regions (%) | 2.88 |
| Residues in coiled-coil regions (%) | 16.02 |
| Predicted disordered residues (%) | 18.96 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08393 |
| Sequences matching dominant architecture (%) | 91.94 |
| Average overlap percent | 11.73 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0Q3PNQ9 | 1288-1394 | 107 | FYKDYDEKGPSEENVPPHEASDRLQIFQAKFDELWRKYISLSGGEELFGLPITEYPELHKIKRELSMLQKLYSLYNSVIASIDGY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q4CV55-F1 | 945-1013 | 70.41 | 83.62 | View in AlphaFoldDB ↗ |