DPCfam | MC267287
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 531 |
|---|---|
| Mean domain length (aa) | 229 ± 25 aa |
| Residues in low-complexity regions (%) | 6.46 |
| Residues in coiled-coil regions (%) | 0.45 |
| Predicted disordered residues (%) | 2.45 |
| Average transmembrane regions | 4.74 |
| Dominant Pfam architecture(s) | PF12166 |
| Sequences matching dominant architecture (%) | 95.93 |
| Average overlap percent | 16.16 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1I7S5E4 | 1454-1686 | 233 | DFYPYIFFLDIFCILILTFQYQSFGELSQEQLSLLDSSRVPLMFVVMLFASFTMIIIERALYLRKAVFWKLIYHVFLIAFLHIWV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A2R8QBN7-F1 | 41-280 | 99.58 | 86.93 | View in AlphaFoldDB ↗ |