DPCfam | MC266767
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 401 |
|---|---|
| Mean domain length (aa) | 192 ± 24 aa |
| Residues in low-complexity regions (%) | 15.97 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 1.74 |
| Average transmembrane regions | 5.54 |
| Dominant Pfam architecture(s) | PF01891 |
| Sequences matching dominant architecture (%) | 99.17 |
| Average overlap percent | 93.35 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00056DCE05 | 1-163 | 163 | MHIPAGFYPDFLLILGNTITIPFILIAIWRTETRFWSGWSEGLQISAIFVALTGLYMLQADIKPGMAVHWLGVMLTVMMIGPWTA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O28435-F1 | 1-192 | 100.00 | 92.07 | View in AlphaFoldDB ↗ |