DPCfam | MC266730
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 370 ± 84 aa |
| Residues in low-complexity regions (%) | 3.98 |
| Residues in coiled-coil regions (%) | 0.05 |
| Predicted disordered residues (%) | 58.18 |
| Average transmembrane regions | 0.62 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A5K947 | 4-478 | 475 | YQKIECIKKYTNYKDEIERKIGELLTKNDSYFCRKCHTIKTDITKKNDELKDCYKIKSISQPLIESYDIKGFIDECTAYHQCIKN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7PUL9-F1 | 10-380 | 52.94 | 61.89 | View in AlphaFoldDB ↗ |