DPCfam | MC26666
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 146 ± 16 aa |
| Residues in low-complexity regions (%) | 4.28 |
| Residues in coiled-coil regions (%) | 0.19 |
| Predicted disordered residues (%) | 38.04 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF11176 |
| Sequences matching dominant architecture (%) | 96.53 |
| Average overlap percent | 94.68 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B0EEQ1 | 15-147 | 133 | HPNSRKAKRKAKEEQRDTKLKMEKKLHRVLKQTPLVDMVKWFRDGITALGINETNIRVVTQEELFVLAVNYSCRKDLEYDDIDDK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1GWT6-F1 | 16-161 | 98.65 | 91.24 | View in AlphaFoldDB ↗ |