DPCfam | MC266514
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 2611 |
|---|---|
| Mean domain length (aa) | 109 ± 19 aa |
| Residues in low-complexity regions (%) | 0.9 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.83 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF02362 |
| Sequences matching dominant architecture (%) | 85.9 |
| Average overlap percent | 76.73 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1U8FZX0 | 30-131 | 102 | IVSSFFKVMVDVLLFEVLHFPPSFAQLVSHLTDQETYLEDSSGQRWRVGICNHDGSLAIRQGWRTFSSEHGLKLGNFLVFHYIQC... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P0CAP5-F1 | 8-90 | 90.00 | 83.66 | View in AlphaFoldDB ↗ |