DPCfam | MC265652
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 514 ± 80 aa |
| Residues in low-complexity regions (%) | 2.25 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.81 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009050A79 | 45-508 | 464 | KAEENFYRGAPPEWLNFYISEQAESHGTAFIKRDGYEKLKKQIQGNRKFPGISTVKLSHQPGCGGTTMAMQVLWDLRKTFRCAVL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0G2JVT8-F1 | 592-1132 | 99.81 | 89.69 | View in AlphaFoldDB ↗ |