DPCfam | MC2654
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 723 ± 78 aa |
| Residues in low-complexity regions (%) | 1.42 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.31 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0006AB5239 | 1733-2334 | 602 | EVTLPTFRLPPMQNNIAIPAMGNMTFDFSFKSAVISFIASAGLYNQSDIVARFGTSSTSAFDILNIKIDGTASLTRTRGIKVASA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A286YBH9-F1 | 1754-2160 | 61.37 | 49.08 | View in AlphaFoldDB ↗ |