DPCfam | MC265365
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 541 |
|---|---|
| Mean domain length (aa) | 275 ± 28 aa |
| Residues in low-complexity regions (%) | 16.67 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 35.79 |
| Average transmembrane regions | 1.06 |
| Dominant Pfam architecture(s) | PF06013 |
| Sequences matching dominant architecture (%) | 0.85 |
| Average overlap percent | 25.55 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H0QYA1 | 23-340 | 318 | LGGTPTSVVAGADKYLKFADHADNAARLLRSLDTADFQGDEAEKFRSKLDDRLPDWLTKVATAHRNVGTGIKVFGGVFTTEHTLM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EZY5-F1 | 76-352 | 98.59 | 59.07 | View in AlphaFoldDB ↗ |