DPCfam | MC265048
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 1240 ± 121 aa |
| Residues in low-complexity regions (%) | 2.59 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.43 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13020 |
| Sequences matching dominant architecture (%) | 19.44 |
| Average overlap percent | 4.99 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W0ET12 | 37-1460 | 1424 | ERQIVNGYQGRQLLEMLQNADDSGATEITITFKDNTLTISDNGQGFSLEGIQSLFIPNCSSKANCSDNIGNKGIGFRSILNWSND... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A368UN07-F1 | 49-504 | 34.91 | 86.20 | View in AlphaFoldDB ↗ |