DPCfam | MC264911
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 81 ± 11 aa |
| Residues in low-complexity regions (%) | 13.63 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 35.35 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF05345 |
| Sequences matching dominant architecture (%) | 0.78 |
| Average overlap percent | 12.1 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A066UQ12 | 1-70 | 70 | MKKQGLLAASIAVALVGCGSDSDSSGPTSFSITAIDGYLANANVSVDSTQDGVCDLSQGKTDNKGQANLS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q54TT6-F1 | 194-229 | 49.40 | 88.34 | View in AlphaFoldDB ↗ |