DPCfam | MC264548
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 72 ± 10 aa |
| Residues in low-complexity regions (%) | 11.97 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.32 |
| Average transmembrane regions | 0.56 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0005B9FF5E | 12-83 | 72 | NLGGVFISTSQIYQLLLELKYDFKAMDIKLDASSAASSDHETRIRGLEKWKYAISASLISSLAALAIALIKL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8HY03-F1 | 97-122 | 36.11 | 77.74 | View in AlphaFoldDB ↗ |