DPCfam | MC264459
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 561 |
|---|---|
| Mean domain length (aa) | 248 ± 47 aa |
| Residues in low-complexity regions (%) | 1.74 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.41 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF12224 |
| Sequences matching dominant architecture (%) | 82.8 |
| Average overlap percent | 70.82 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009829924 | 38-305 | 268 | FGIELEFLMSAKGSDNQLQTGESLRQHLVQKWNQKMKNELGFIPMESGYSTPGYAKWRLVSEFPLENYSQGKWPLEIVSPIFYYR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175VTD1-F1 | 8-274 | 97.54 | 92.37 | View in AlphaFoldDB ↗ |