DPCfam | MC264452
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 511 |
|---|---|
| Mean domain length (aa) | 100 ± 8 aa |
| Residues in low-complexity regions (%) | 16.51 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 32.54 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04576 |
| Sequences matching dominant architecture (%) | 97.96 |
| Average overlap percent | 87.84 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A124SGH0 | 336-439 | 104 | SSSLQCLKKQARIDRKNLVTLTMELEEERSAAAVAANNAMAMITRLQAEKAAVQMEALQYQRMMEEQAEYDQEAIQILQDLVAKR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q10NT0-F1 | 530-631 | 98.08 | 95.54 | View in AlphaFoldDB ↗ |