DPCfam | MC264118
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 118 ± 15 aa |
| Residues in low-complexity regions (%) | 0.51 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.8 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01507 |
| Sequences matching dominant architecture (%) | 21.28 |
| Average overlap percent | 8.41 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M7B7U2 | 201-306 | 106 | ETLLAPVLNQANARFGRHAHLGSYPDWVNNYYRVRLTLDSESEQHLEEAYSFLMQNLPPALIVPLVTDPVARAATDVYALAESGS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6ING7-F1 | 188-305 | 99.17 | 95.70 | View in AlphaFoldDB ↗ |