DPCfam | MC26386
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 78 ± 8 aa |
| Residues in low-complexity regions (%) | 1.04 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.94 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05067 |
| Sequences matching dominant architecture (%) | 71.7 |
| Average overlap percent | 52.08 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W4BHJ8 | 4-76 | 73 | PDKPDPAAAKVLQEALGGRFGEMRTMMQYFFQSSNFRGNKAQYRDLIRGVFLEEISHVELVQTTINQLLNGSG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q45538-F1 | 1-80 | 98.81 | 97.46 | View in AlphaFoldDB ↗ |