DPCfam | MC263848
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 121 ± 13 aa |
| Residues in low-complexity regions (%) | 1.01 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.07 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF17944 |
| Sequences matching dominant architecture (%) | 36.47 |
| Average overlap percent | 3.73 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00035F2EBD | 458-587 | 130 | YLCNFSVFQSAADTWAIDQLLPVVPLTRMNEKPSVNCTLVDITCDSDGKLDQFSVGREITDILPMHPLKEGENYYAGLFLTGAYQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8YRP3-F1 | 506-630 | 98.44 | 94.56 | View in AlphaFoldDB ↗ |