DPCfam | MC26349
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 246 ± 29 aa |
| Residues in low-complexity regions (%) | 2.18 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.85 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF10245 |
| Sequences matching dominant architecture (%) | 90.91 |
| Average overlap percent | 92.02 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0B1S1M7 | 41-269 | 229 | SVDAEKLFINADVQRLLTELTGMDLEGKVFKTRRTEIQQRSHFALMTDERLAETMEKMKSEARRFLNFVPLKEPRSQEVTILSRD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9U3Q0-F1 | 42-288 | 98.80 | 90.44 | View in AlphaFoldDB ↗ |