DPCfam | MC263245
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 200 ± 20 aa |
| Residues in low-complexity regions (%) | 3.45 |
| Residues in coiled-coil regions (%) | 0.54 |
| Predicted disordered residues (%) | 14.24 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R4LE89 | 72-257 | 186 | IMDLLPPPAANRVAAFNSLYYTITDRVARALGGPQVADPAFLELLDVEFAKRYFDALRLWGEEDHTTPDAWEVLFRRAQDQRVSR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0F4I9-F1 | 60-260 | 95.48 | 91.60 | View in AlphaFoldDB ↗ |