DPCfam | MC262948
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 146 ± 12 aa |
| Residues in low-complexity regions (%) | 8.39 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 4.5 |
| Average transmembrane regions | 2.68 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0C3F4V3 | 25-156 | 132 | TTSPFELICSDVVICFRKLGYFMGIMVPLTPYGSGALDEFYPSVQNLWAMFVHALLVFVELAFLLSVPFFVFFIGIGCMVYSAIV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175WCT3-F1 | 30-166 | 98.58 | 90.40 | View in AlphaFoldDB ↗ |