DPCfam | MC262912
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 108 ± 11 aa |
| Residues in low-complexity regions (%) | 0.66 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.44 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10433 |
| Sequences matching dominant architecture (%) | 1.19 |
| Average overlap percent | 20.5 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K7GNU1 | 243-358 | 116 | ARFRYFEDIYGYSGVFICGPSPHWLLVTGRGALRLHPMGIDGPIDSFAPFHNVNCPRGFLYFNRQGELRISVLPAYLSYDAPWPV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R4IC37-F1 | 945-1048 | 99.05 | 92.33 | View in AlphaFoldDB ↗ |