DPCfam | MC262905
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 174 ± 11 aa |
| Residues in low-complexity regions (%) | 2.03 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 31.61 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF09339 |
| Sequences matching dominant architecture (%) | 1.38 |
| Average overlap percent | 34.09 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1Q8QSY6 | 14-161 | 148 | CLGHLRQNGFVASAEGVHQITDKGRQFLADGRTITSGPCSGNAASRRGLSLRQRAWRAMGMRDGFSLDDLLTMLCDGSEKEPERN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8TYM5-F1 | 152-235 | 47.70 | 89.61 | View in AlphaFoldDB ↗ |