DPCfam | MC262793
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 194 ± 23 aa |
| Residues in low-complexity regions (%) | 2.33 |
| Residues in coiled-coil regions (%) | 0.48 |
| Predicted disordered residues (%) | 28.82 |
| Average transmembrane regions | 0.07 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0003832592 | 712-855 | 144 | PSGLTDIKAALEICEFALNVITGITPNETVPIAAQQQVIATWVKAKQLNQEQIGHKLGPEEENNDEAQNPMTRILVGLEMYSCNG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-E9Q2C0-F1 | 780-965 | 99.01 | 76.22 | View in AlphaFoldDB ↗ |