DPCfam | MC262599
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 213 ± 29 aa |
| Residues in low-complexity regions (%) | 3.92 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 34.95 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W3XIX6 | 11-227 | 217 | PPPYSARAGNPVEEAVDHLILVLEGRSIYPESAANPPLYTLSHEIAGLPESASLVKLERLDRMVRSSPDGAPRTTCRTKHIYNLQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175VZ36-F1 | 19-239 | 98.17 | 86.23 | View in AlphaFoldDB ↗ |