DPCfam | MC262396
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 114 ± 8 aa |
| Residues in low-complexity regions (%) | 4.11 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.47 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05985 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 49.39 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00037C133F | 10-127 | 118 | TPSPWEELRAHTRARIALGRAGHSLPTREVLAFGEAHARARDAVHTPVDFGAVEAVLGEAGVPHLHLQTEADSRETYLRRPDLGR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B1J153-F1 | 10-129 | 99.14 | 94.88 | View in AlphaFoldDB ↗ |