DPCfam | MC262059
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 221 |
|---|---|
| Mean domain length (aa) | 147 ± 19 aa |
| Residues in low-complexity regions (%) | 2.65 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.11 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF04841 |
| Sequences matching dominant architecture (%) | 96.95 |
| Average overlap percent | 49.72 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| D7GXI5 | 5-160 | 156 | MLTADWFLLGRDLYFRKFEIYTMGWHQDINLENFIASSAPYGGPIAIRRDEQKFIKVQGSGQPIISIFSGSGRQITSFKWTKRPI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0NFB5-F1 | 8-161 | 100.00 | 92.20 | View in AlphaFoldDB ↗ |