DPCfam | MC261999
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 134 ± 7 aa |
| Residues in low-complexity regions (%) | 2.89 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 7.06 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF14175 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 45.37 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A160FB34 | 175-311 | 137 | ILIPVTILDDYHMTFSHFISHVIPEWHWIQKESVEIEGNYIKAICTDQLKSLEHEPFMFDLSTKTYRLPTQREEIFQKQEVIFHY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P37526-F1 | 181-312 | 99.25 | 95.89 | View in AlphaFoldDB ↗ |