DPCfam | MC261910
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 84 ± 9 aa |
| Residues in low-complexity regions (%) | 5.28 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.59 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01636 |
| Sequences matching dominant architecture (%) | 92.86 |
| Average overlap percent | 24.14 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0003615B5E | 3-81 | 79 | SVCDRMGLDGSDACLVQHAANALFRLPGAGVMLRLSTQPVDRLVRVARELSAAGVPVADLAPGVPQPVTADGWWATAWT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0F2E5-F1 | 2-85 | 97.73 | 92.27 | View in AlphaFoldDB ↗ |