DPCfam | MC261840
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 281 |
|---|---|
| Mean domain length (aa) | 395 ± 64 aa |
| Residues in low-complexity regions (%) | 11.74 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.41 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A177HTQ0 | 55-423 | 369 | PADRARLRDDWALLEAADRADRHAVREVLLHPTVGPWALDCLRALTGPGALTRPRPDLTHLGAVATAAGVRAGLDFSIRLKSRRG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0ENE6-F1 | 116-296 | 45.86 | 90.81 | View in AlphaFoldDB ↗ |