DPCfam | MC26177
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 119 ± 10 aa |
| Residues in low-complexity regions (%) | 1.8 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.95 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00924 |
| Sequences matching dominant architecture (%) | 4.11 |
| Average overlap percent | 1.74 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1D1Y4P5 | 23-148 | 126 | GVDMERLRRLSRARATACGVRRLVGHVISRGLSSSISRTAEEFGRSDAESEITSEWEARCAAERVFKNVAQPGHKYIEEEDLLRF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7LLZ5-F1 | 553-670 | 97.54 | 72.61 | View in AlphaFoldDB ↗ |