DPCfam | MC261713
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 83 ± 12 aa |
| Residues in low-complexity regions (%) | 0.41 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.5 |
| Average transmembrane regions | 0.1 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q8ND61 | 747-833 | 87 | IQCRYDSYRLLQYDLDSPLQEDPPLMVKKNSVVQGMILMFAGGKLIFGGRVLNGYGLSKQNLLKQIFRSQQDYKMGYFLPDDYKF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8CDN1-F1 | 741-825 | 98.88 | 87.02 | View in AlphaFoldDB ↗ |