DPCfam | MC261687
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 127 ± 22 aa |
| Residues in low-complexity regions (%) | 8.99 |
| Residues in coiled-coil regions (%) | 40.39 |
| Predicted disordered residues (%) | 43.09 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF11221 |
| Sequences matching dominant architecture (%) | 87.5 |
| Average overlap percent | 93.13 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| L8GDX5 | 25-188 | 164 | VTDRVTQLQDKIDGLGEKFYTFIGVLQQDAPPLPFDEFKHLNRTADGPKTVANGANAAVADGGPVLPVLPSMPMPEPAAPVPTGP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5AZQ7-F1 | 2-190 | 98.46 | 72.23 | View in AlphaFoldDB ↗ |