DPCfam | MC261647
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 367 ± 48 aa |
| Residues in low-complexity regions (%) | 5.16 |
| Residues in coiled-coil regions (%) | 8.98 |
| Predicted disordered residues (%) | 46.19 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| N4X5C1 | 6-403 | 398 | PPPRTSASEMTEEEIEKMIKDHDVLREKYQKVKRYFFEQQTQVHQLQNTLANQRLSVSRTSWDDSEYSTRFNRLDGLIAQLSFSI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0NX48-F1 | 459-906 | 99.21 | 74.78 | View in AlphaFoldDB ↗ |