DPCfam | MC261577
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 60 ± 13 aa |
| Residues in low-complexity regions (%) | 0.91 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.91 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF01150 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 24.72 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1I8CWJ2 | 377-434 | 58 | YPDADESRLKENCFKTAWSMTTLHKGFGFNTDKINFKSAYKIGNQEVQWALGAMIYHM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q617Y0-F1 | 411-469 | 100.00 | 93.09 | View in AlphaFoldDB ↗ |