DPCfam | MC261459
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 106 ± 15 aa |
| Residues in low-complexity regions (%) | 3.76 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 9.34 |
| Average transmembrane regions | 1.14 |
| Dominant Pfam architecture(s) | PF02386 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 30.14 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0W0GBM9 | 493-581 | 89 | LYSVEWILFEVLNIGLEAYESLTIGPRIICGLFQGLAARASGFSIVPLASLAPALQFLYVVMMYIAIYPIAISIRSTNTYEEQSL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2GFM6-F1 | 539-657 | 100.00 | 76.09 | View in AlphaFoldDB ↗ |