DPCfam | MC26137
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 82 ± 10 aa |
| Residues in low-complexity regions (%) | 4.74 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.49 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06535 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 46.81 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000A2C0826 | 20-102 | 83 | LLIIVCCLTLAASSDCKVHLCSKQYSRALDEDNVVESATYRYCSLLKSYNDCMEATGRSCRGNLGYHSFQTLISNWAKTYNCE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8JG54-F1 | 19-99 | 96.47 | 81.85 | View in AlphaFoldDB ↗ |